DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ced-12 and AT1G03620

DIOPT Version :9

Sequence 1:NP_609548.1 Gene:Ced-12 / 34633 FlyBaseID:FBgn0032409 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001321012.1 Gene:AT1G03620 / 839448 AraportID:AT1G03620 Length:297 Species:Arabidopsis thaliana


Alignment Length:263 Identity:52/263 - (19%)
Similarity:103/263 - (39%) Gaps:59/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LNALFVKADEGRRRTIAQTISAKQFRLALIGNGLGTEMTHQLYVLQTLTLGLLEKRMRMKMNAQD 308
            :..||.:::..:.:.:..|:|.                      ||...|..|:.||.:..:...
plant    72 IGGLFTRSNRRQDKAVDYTLSP----------------------LQEERLQRLQDRMVVPFDETR 114

  Fly   309 QDAHEKIKELRRIAFDDNTNALNQNDDHIRRGGGSGAGNVNF----SQYYKKLGFKCDINPAQDF 369
            .|..|.:|.|..:||.                      ||:.    ::.:|::|:: ..||:.||
plant   115 PDHQESLKALWNVAFP----------------------NVHLTGLVTEQWKEMGWQ-GPNPSTDF 156

  Fly   370 IETPPGILALDCMVYFARNYTQQYAKIVRENSCRADEHECPFGRTSIELVKVLCDILRIGEPPAE 434
              ...|.:||:.:::.||.|...:.:::.:......:.|.||....|.:..:|..:|.:...|..
plant   157 --RGCGFIALENLLFSARTYPVCFRRLLLKQRGDRAKWEYPFAVAGINISFMLIQMLDLQNNPKP 219

  Fly   435 Q---SGDFQPMFFTHDSPFEEFFCICVITLNRTWKDMRATAEDFSTTFSVVREQIQRTLKGRPEN 496
            :   ..:|..:....:..|:..:||....::..|..|.|:..:|:......|.|::|.|     :
plant   220 KCLPGMNFLKLLEEDERAFDVLYCIAFAMMDAQWLAMHASYMEFNEVLQATRNQLEREL-----S 279

  Fly   497 LDD 499
            |||
plant   280 LDD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ced-12NP_609548.1 DUF3361 122..275 CDD:288674 4/30 (13%)
ELMO_CED12 296..474 CDD:282570 37/184 (20%)
PH_ELMO1_CED-12 546..673 CDD:270166
AT1G03620NP_001321012.1 ELMO_CED12 100..267 CDD:398415 38/191 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102058
Panther 1 1.100 - - LDO PTHR12771
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.