DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ced-12 and AT3G43400

DIOPT Version :9

Sequence 1:NP_609548.1 Gene:Ced-12 / 34633 FlyBaseID:FBgn0032409 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_189926.1 Gene:AT3G43400 / 823420 AraportID:AT3G43400 Length:213 Species:Arabidopsis thaliana


Alignment Length:185 Identity:31/185 - (16%)
Similarity:74/185 - (40%) Gaps:40/185 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 RMKMNAQDQDAHEKIKELRRIAFDDNTNALNQNDDHIRRGGGSGAGNVNFSQYYKKLGFKCDINP 365
            |:|.:.....|.||:::|                               .|..:|.:|::.. :|
plant    64 RIKKSLTSTYADEKLQDL-------------------------------ISDQWKNMGWQRK-DP 96

  Fly   366 AQDFIETPPGILALDCMVYFARNYTQQYAKIVRENSCRADEHECPFGRTSIELVKVLCDILRI-- 428
            :.||  ...|.::|:.:.:||:.    :::::::...:....|.||....:.:..::..:|.:  
plant    97 STDF--RGDGFISLENLRFFAKT----FSRLLKKQGGKRAAWEYPFAVAGVNITFMIMQMLDLEA 155

  Fly   429 GEPPAEQSGDFQPMFFTHDSPFEEFFCICVITLNRTWKDMRATAEDFSTTFSVVR 483
            .:|.:.....|..|....:..|...:|:..:.:::.|.|..||..:|:.....|:
plant   156 SKPRSFIRLVFLQMLSESEWAFGLLYCVAFVVMDKQWLDKNATYMEFNDVLRYVQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ced-12NP_609548.1 DUF3361 122..275 CDD:288674
ELMO_CED12 296..474 CDD:282570 29/174 (17%)
PH_ELMO1_CED-12 546..673 CDD:270166
AT3G43400NP_189926.1 ELMO_CED12 65..201 CDD:282570 28/173 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D234725at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12771
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.