DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ced-12 and AT3G03610

DIOPT Version :9

Sequence 1:NP_609548.1 Gene:Ced-12 / 34633 FlyBaseID:FBgn0032409 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_001326125.1 Gene:AT3G03610 / 821208 AraportID:AT3G03610 Length:335 Species:Arabidopsis thaliana


Alignment Length:355 Identity:71/355 - (20%)
Similarity:138/355 - (38%) Gaps:49/355 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ILKYSLASFVELMEHGTVSWEVPENSFVARNIEIVRNFQKYPTNCGESALSNLENIVMCSNKHVL 214
            |.|.:.|:....:.||.|..               |.:::|.....|:....|.......|....
plant    10 IYKMASATLRRRLHHGDVDG---------------RKYERYDATDSETLSEPLLGSSSTDNSRNE 59

  Fly   215 VAEDIKLQDIL---RLLQDVNSPVMRQNAIALLNALFVKADEGRRRTIAQTISAKQFRLALIGNG 276
            ..|:..|:||.   |..|.|:..::....||.......|...|....:.:.:|...|  ..||.|
plant    60 YIEERTLEDIWEEERKRQQVHWTLIFSQLIAQWAQWIAKIVFGSGSLVGRFLSLPTF--GQIGTG 122

  Fly   277 LGTEMTHQLYVLQTLTLGLLEKRMRMKMNAQDQDAHEKIKELRRIAFDDNTNALNQNDDHIRRGG 341
             |..:...|.:||...|..:::|:.:..:....:..:.:::|.|:|:........:         
plant   123 -GRLLPPPLSMLQEERLRNIKRRIEIPFDGSRMEHQDALRQLWRLAYPQRELPPLK--------- 177

  Fly   342 GSGAGNVNFSQYYKKLGFKCDINPAQDFIETPPGILALDCMVYFARNYTQQYAKIVRENSCRADE 406
                     |:.:|::|:: ..:|:.||  ...|.::|:.:::||:.|.:.:.:::.:......|
plant   178 ---------SELWKEMGWQ-GTDPSTDF--RGGGYISLENLIFFAKTYPESFQRLLHKQDGTRAE 230

  Fly   407 HECPFGRTSIELVKVLCDILRI--GEPPAEQSGDFQPMFFTHDSPFEEFFCICVITLNRTWKDMR 469
            .|.||....|.:..:|..:|.:  |:|.......|.......:..|:..:||....::..|...|
plant   231 WEYPFAVAGINISFMLAQMLDLQSGKPSTIAGIRFLGFLEEDEMAFDNLYCIAFQMMDAQWLARR 295

  Fly   470 ATAEDFSTTFSVVREQIQRTLKGRPENLDD 499
            |:..:|:......|.|::|.|.     |||
plant   296 ASYMEFNDVLKSTRAQLERELA-----LDD 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ced-12NP_609548.1 DUF3361 122..275 CDD:288674 25/127 (20%)
ELMO_CED12 296..474 CDD:282570 31/179 (17%)
PH_ELMO1_CED-12 546..673 CDD:270166
AT3G03610NP_001326125.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12771
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.