DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ced-12 and AT2G44770

DIOPT Version :9

Sequence 1:NP_609548.1 Gene:Ced-12 / 34633 FlyBaseID:FBgn0032409 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_566027.1 Gene:AT2G44770 / 819086 AraportID:AT2G44770 Length:266 Species:Arabidopsis thaliana


Alignment Length:252 Identity:56/252 - (22%)
Similarity:108/252 - (42%) Gaps:40/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 ALIGNGLG----------TEMTHQLYVLQTLTLGLLEKRMRMKMNAQDQDAHEKIKELRRIAF-D 324
            |.:|.||.          ...|..|...|...|..|:.|:.:..::......|.::||.:::| :
plant    37 AWLGRGLSCVCAQRRDSDANSTFDLTPAQEECLQSLQNRIDVAYDSTIPLHQEALRELWKLSFPE 101

  Fly   325 DNTNALNQNDDHIRRGGGSGAGNVNFSQYYKKLGFKCDINPAQDFIETPPGILALDCMVYFARNY 389
            :..:.|                   .|:.:|::|:: ..:|:.||  ...|.::|:.::|||||:
plant   102 EELHGL-------------------ISEQWKEMGWQ-GKDPSTDF--RGGGFISLENLLYFARNF 144

  Fly   390 TQQYAKIVRENSCRADEHECPFGRTSIELVKVLCDILRIG--EPPAEQSGDFQPMFFTHDSPFEE 452
            .:.:..::|:........|.||....|.|..:|..:|.:.  :|.......|......::|.|:.
plant   145 QKSFQDLLRKQVGDRSVWEYPFAVAGINLTFMLIQMLDLEAVKPRTIVGATFLKFLSENESAFDL 209

  Fly   453 FFCICVITLNRTWKDMRATAEDFSTTFSVVREQIQRTLKGRPENLDDFRNKIALLTY 509
            .:||....:::.|..|||:..:|:|.....|.|::|.|.     |:|..:...|.:|
plant   210 LYCIAFKLMDQQWLSMRASYMEFNTVMKSTRRQLERELM-----LEDIMHLEDLPSY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ced-12NP_609548.1 DUF3361 122..275 CDD:288674 1/3 (33%)
ELMO_CED12 296..474 CDD:282570 38/180 (21%)
PH_ELMO1_CED-12 546..673 CDD:270166
AT2G44770NP_566027.1 ELMO_CED12 70..236 CDD:398415 40/187 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12771
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.