DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ced-12 and C56G7.3

DIOPT Version :9

Sequence 1:NP_609548.1 Gene:Ced-12 / 34633 FlyBaseID:FBgn0032409 Length:724 Species:Drosophila melanogaster
Sequence 2:NP_497699.1 Gene:C56G7.3 / 175439 WormBaseID:WBGene00008348 Length:322 Species:Caenorhabditis elegans


Alignment Length:311 Identity:66/311 - (21%)
Similarity:110/311 - (35%) Gaps:90/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 VLVAEDIKLQDILRLL---------------QDVNSP---VMRQNAIALLNALFVKADEGRRRTI 259
            |.||.:..|||:..||               .||..|   |:.:.:|            ..|.|.
 Worm    48 VAVAPETSLQDLYPLLIATSSSNAPPSATPTDDVTDPEVQVVSRESI------------DNRSTF 100

  Fly   260 AQTISAKQFRLALIGNGLGTEMTHQLYVLQTLTLGLLEKRMRMKMNAQDQDAHEKIKELRRIA-- 322
            .:.|.      ..:...:.::|..:.|..:||.|.|          ||....||.......::  
 Worm   101 NRIID------VCLCRPVKSQMGPKAYTDKTLILKL----------AQIPYDHENGTHWLLLSDY 149

  Fly   323 FDDNTNALNQNDD--HIRRGGGSGAGNVNFSQYYKKLGFKCDINPAQDFIETPPGILALDCMVYF 385
            |::.:.:|..:.:  |:......||       ::..:||: ...|..||  ...|:|.|..|   
 Worm   150 FNNVSRSLMTSSEYSHVTNPSRVGA-------HWVTVGFQ-SATPHTDF--RGCGVLGLLQM--- 201

  Fly   386 ARNYTQQYAKIVRENSCRA-------DEHECPFGRTSIELVKVLCDILRIGEPPAEQSGD----F 439
             ..:||:    |..|..||       :.::.|....||.:..:|...|:.|  ..:..|:    .
 Worm   202 -HTFTQR----VPANLLRAIVLLATTEPNDFPLAVVSINITSILLTQLKKG--ALDNFGNEIEGL 259

  Fly   440 QPMFFT-HDSPFEEFFCICVITLNRTWKDMRATAEDFSTTFSVVREQIQRT 489
            .|.|.. |.|....|   |.|     :|..:.|..:..|.||.:..|::::
 Worm   260 YPFFSALHASAMCRF---CSI-----YKSQKCTLANTQTIFSEITRQLEKS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ced-12NP_609548.1 DUF3361 122..275 CDD:288674 16/79 (20%)
ELMO_CED12 296..474 CDD:282570 40/193 (21%)
PH_ELMO1_CED-12 546..673 CDD:270166
C56G7.3NP_497699.1 ELMO_CED12 127..284 CDD:282570 41/194 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.