DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6712 and IMP4

DIOPT Version :9

Sequence 1:NP_477479.1 Gene:CG6712 / 34631 FlyBaseID:FBgn0032408 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001358654.1 Gene:IMP4 / 92856 HGNCID:30856 Length:319 Species:Homo sapiens


Alignment Length:338 Identity:106/338 - (31%)
Similarity:161/338 - (47%) Gaps:68/338 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 MRNKEQRLA---LYKKMKKEKHKKKMQERRARRKAGVPANPGHTIESLREKDQTEVANLNDSDNE 164
            |..:|.||.   ||:|.::|. ::..|||:.|.:..:..|.....|..||.             .
Human     1 MLRREARLRREYLYRKAREEA-QRSAQERKERLRRALEENRLIPTELRREA-------------L 51

  Fly   165 ELQKELQLDD-----FSSYFERSY------EPKVLITFADNPVTKTRKFGLELSRIFPNALVKIR 218
            .||..|:.||     .:|:.:..|      :|||:||.:.:|.::.:.|..||..:||.|....|
Human    52 ALQGSLEFDDAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNR 116

  Fly   219 NKSSVKKICKSAEREEFTDVVIVNEDRRKPNGLLVIHLPNGPTAHFKLSNVKLTSDIKRDHKEIT 283
            .:..|..:.::.:....||:::|:|.|..|.||:|.|||.||||:|.|.||.:..||. |...::
Human   117 GRHEVGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIP-DLGTMS 180

  Fly   284 KHRPEVILNNFTTRLGLTVGRMLGAL---------FHHD--------------------PEFRGR 319
            :.:|.:|.:.|::|||..|.  |||.         ..|.                    |:....
Human   181 EAKPHLITHGFSSRLGKRVS--LGAFRLGLRARPGICHSVSLSFLVPQVSDILRYLFPVPKDDSH 243

  Fly   320 RAVTFHNQRDYIFFRHHRYEFTKEGKRVKLRELGPRFTLKLRSLQEGTFDSK-TGDYAWIISNKR 383
            |.:||.||.|||.||||.|:.| :.:.|:|.|:||||.|||..::.||.:.: |.|..|    :.
Human   244 RVITFANQDDYISFRHHVYKKT-DHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEW----RW 303

  Fly   384 H--AMESRRRFFL 394
            |  ...:|:|.||
Human   304 HPYTNTARKRVFL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6712NP_477479.1 Brix 188..358 CDD:214879 67/198 (34%)
IMP4NP_001358654.1 Brix 86..281 CDD:214879 67/198 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2136
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D768872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.