DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6712 and imp4

DIOPT Version :9

Sequence 1:NP_477479.1 Gene:CG6712 / 34631 FlyBaseID:FBgn0032408 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001016629.1 Gene:imp4 / 549383 XenbaseID:XB-GENE-6040852 Length:291 Species:Xenopus tropicalis


Alignment Length:295 Identity:100/295 - (33%)
Similarity:158/295 - (53%) Gaps:42/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 MRNKEQRLA---LYKKMKKEK----HKKKMQERRA-RRKAGVPANPGHTIESLREKDQTEVANLN 159
            |..:|.||.   ||:|.::.|    ..|||:.:|| .....:|.       .:|.:..|      
 Frog     1 MLRREARLRREYLYRKAQEAKLHSIEDKKMRLKRALEENRLIPT-------EIRREALT------ 52

  Fly   160 DSDNEELQKELQLDD-----FSSYFERSY------EPKVLITFADNPVTKTRKFGLELSRIFPNA 213
                  |||:|:.||     .||:.:..|      :||:::|.:.:|.::.:.|..|:..|||||
 Frog    53 ------LQKQLEFDDEGGEGVSSHMDDEYKWAGVADPKIMVTTSRDPSSRLKIFAKEMRLIFPNA 111

  Fly   214 LVKIRNKSSVKKICKSAEREEFTDVVIVNEDRRKPNGLLVIHLPNGPTAHFKLSNVKLTSDIKRD 278
            ....|.|..|..:.::....:.||::||:|.|..|:||:|.|||.||||:|.|.||.:..||. |
 Frog   112 QRMNRGKHEVGALVQACRANDVTDLLIVHEHRGMPDGLIVCHLPFGPTAYFTLCNVVMRHDIP-D 175

  Fly   279 HKEITKHRPEVILNNFTTRLGLTVGRMLGALFHHDPEFRGRRAVTFHNQRDYIFFRHHRYEFTKE 343
            ...:::..|.:|.:||::|||..|..::..|| ..|:...:|.:||.||.|||.||||.|..| :
 Frog   176 LGTMSEAHPHLIFHNFSSRLGQRVADIMKYLF-PVPKEESKRVITFANQDDYISFRHHTYRRT-D 238

  Fly   344 GKRVKLRELGPRFTLKLRSLQEGTFDSK-TGDYAW 377
            .:.::|.|:||||.:||..::.||.::: |.:..|
 Frog   239 HRNIELTEVGPRFEMKLYMIKLGTLENEGTSEVEW 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6712NP_477479.1 Brix 188..358 CDD:214879 67/169 (40%)
imp4NP_001016629.1 Brix 86..253 CDD:214879 67/169 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D768872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.