DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6712 and CG11920

DIOPT Version :9

Sequence 1:NP_477479.1 Gene:CG6712 / 34631 FlyBaseID:FBgn0032408 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_651335.2 Gene:CG11920 / 43009 FlyBaseID:FBgn0039274 Length:298 Species:Drosophila melanogaster


Alignment Length:290 Identity:95/290 - (32%)
Similarity:154/290 - (53%) Gaps:18/290 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KEQRLALYKKMKKE--KHKKKMQERRARRKAGVPANPGHTIESLR-EKDQTEVANLNDSDNEELQ 167
            :::|..||.|...|  |.|:|:||...:     ..|....|.|.. :|..|...:|..:| |.:.
  Fly     7 RQRREYLYNKALTERLKSKQKIQETVVK-----SINENKAIGSKNVKKSLTAYKSLKYAD-EGVD 65

  Fly   168 KELQLDDFSSYFERSYEPKVLITFADNPVTKTRKFGLELSRIFPNALVKIRNKSSVKKICKSAER 232
            .....|::  ::....:||:::|.:.||.::.:.|..||..|.|||....|....:..:..:...
  Fly    66 DRTVNDEY--HYAGCEDPKIMLTTSHNPSSRLKMFMKELRLIIPNAQQMNRGNYQLTTLMHACRA 128

  Fly   233 EEFTDVVIVNEDRRKPNGLLVIHLPNGPTAHFKLSNVKLTSDIKRDHKEITKHRPEVILNNFTTR 297
            ...||.:||:|.|..|:.|:|.|||.||||.|.:|:|.:..||. |...:::.:|.:|.|||.|.
  Fly   129 NNVTDFLIVHEHRGIPDSLVVCHLPYGPTAFFNISDVVMRHDIP-DIGHMSEQKPHLIFNNFKTP 192

  Fly   298 LGLTVGRMLGALFHHDPEFRGRRAVTFHNQRDYIFFRHHRYEFTKEGKRVKLRELGPRFTLKLRS 362
            :||...::|..|| ..|:...:|.::|.|..|.|.||||:|::.  .|.::|.|:||||:|||..
  Fly   193 IGLRTVKILKHLF-PVPKENSQRVMSFLNHNDSIIFRHHQYKYV--NKELELTEVGPRFSLKLYQ 254

  Fly   363 LQEGTFDS-KTGDYAWIISNKRHAMESRRR 391
            ::.||.:: |..|..||  |:.:...|::|
  Fly   255 IKLGTLENIKAADTEWI--NRPYMNTSQKR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6712NP_477479.1 Brix 188..358 CDD:214879 62/169 (37%)
CG11920NP_651335.2 Brix 84..250 CDD:214879 62/169 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450008
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2136
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D768872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22734
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.