DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex19 and PEX19-2

DIOPT Version :9

Sequence 1:NP_609547.2 Gene:Pex19 / 34630 FlyBaseID:FBgn0032407 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_568351.1 Gene:PEX19-2 / 831621 AraportID:AT5G17550 Length:245 Species:Arabidopsis thaliana


Alignment Length:311 Identity:78/311 - (25%)
Similarity:125/311 - (40%) Gaps:100/311 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DELNDLLDSALQDFD-----------KSGAGDQKEPSASSDVATNAGPEGSEDPDAFFIEQAKVL 62
            |:|::||||||.||.           |...||:||        |.:.|.|.:             
plant     8 DDLDELLDSALDDFKDLNLTQRNGGVKKEEGDKKE--------TESLPSGVQ------------- 51

  Fly    63 ADRMNTLFGGPDTPSGDIPPLPQDPDQIMAGFKKMAEAAALTLSGENSATDEDVSKYSDSISQAL 127
                ....|.||..|.            ..|.||:|:...:|         |.:.|..:...:.:
plant    52 ----GLGMGLPDMRSK------------KKGKKKIAKEDHVT---------EALDKLREQTRETV 91

  Fly   128 KGLQE--------GSENLAAPASENDIASMFGSLNLEGAGEGDGNMFLPFMEGMMQSLLSAEILL 184
            |||:.        ||::...........::.||.:||.           .::.|||.|||.:||.
plant    92 KGLESLSSKQQPTGSDDAMVEDWIKQFENLTGSNDLES-----------IVDTMMQQLLSKDILH 145

  Fly   185 PSIRELLEKYPKYLEENDAKLSAEDKERYQKQMELYKVIEGHLQSEKTEDSAAVKREKFRVVLDD 249
            ..::|:..:|||:|||:::.|:.|:.:||.:|.||.|.:....::|....:.         :::.
plant   146 EPMKEIGARYPKWLEEHESSLNKEEFDRYSRQYELIKELNLVYENEPNNSTK---------IMEI 201

  Fly   250 MRKLQDYGQPPPEILAETGGDLPFGDPTAGVAAGG--------PGPQCPTM 292
            |:|:|:.||||.:|:.|.       ||....|:.|        ..|.|..|
plant   202 MQKMQECGQPPSDIVQEM-------DPGFDFASLGQMSPDMLESSPNCCVM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex19NP_609547.2 Pex19 50..292 CDD:282470 59/257 (23%)
PEX19-2NP_568351.1 Pex19 <73..245 CDD:398347 51/207 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I3235
eggNOG 1 0.900 - - E1_KOG3133
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I2466
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282367at2759
OrthoFinder 1 1.000 - - FOG0004307
OrthoInspector 1 1.000 - - otm3028
orthoMCL 1 0.900 - - OOG6_103566
Panther 1 1.100 - - O PTHR12774
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.