DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex19 and pex19

DIOPT Version :9

Sequence 1:NP_609547.2 Gene:Pex19 / 34630 FlyBaseID:FBgn0032407 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001017399.1 Gene:pex19 / 324778 ZFINID:ZDB-GENE-050417-424 Length:288 Species:Danio rerio


Alignment Length:304 Identity:106/304 - (34%)
Similarity:158/304 - (51%) Gaps:50/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELNDLLDSALQDFDKSGAGDQKEPSASSDVATNAGPEGSEDPDAF--FIEQAKVLADR--MNTLF 70
            ||::||||||.||||:..    .|.|         ||...||||.  ..|:..:|.|.  ..:||
Zfish    14 ELDELLDSALDDFDKTSV----PPVA---------PEAPSDPDASAKSNEKPPLLEDSKFFESLF 65

  Fly    71 GGP------DTPSGDIPPLPQDPDQIMAGFKKMAEAAALTLSGENSATDEDVSKYSDSISQALKG 129
            .|.      :.....:..|.|:...::..|.|::|||...  |.:.|:.::   ::..:.:.|.|
Zfish    66 EGEMANQAREEWEKAMAELAQEEPDLLQHFHKLSEAAGKV--GTDVASQQE---FTSCLKETLNG 125

  Fly   130 LQEGSENL-AAPASENDIASMFGSLNLEGAGEG---DGNMFLPFMEGMMQSLLSAEILLPSIREL 190
            |.:.::|| :|..:.:|:.....::.|...||.   |||: ||.|:.:||:|||.|:|.||::|:
Zfish   126 LAKNADNLQSAGLAGDDLVKTLENMGLNENGEAGGEDGNI-LPIMQSIMQNLLSKEVLYPSLKEI 189

  Fly   191 LEKYPKYLEENDAKLSAEDKERYQKQMELYKVIEGHL--QSEKTEDSAAVKREKFRVVLDDMRKL 253
            .:|||::||.|...|.::...||::|   ||:: |.:  |.||.||    |...|..:|:.|:||
Zfish   190 TDKYPEWLESNRQSLPSDQFTRYEQQ---YKIM-GEICNQFEKDED----KDSAFENILELMQKL 246

  Fly   254 QDYGQPPPEILAETGGDLPFGDPTA----GVAAGGPG-PQCPTM 292
            ||.||||.|:..|....|.| ||.|    | |.|.|| .||..|
Zfish   247 QDLGQPPKELAGEAPPGLNF-DPEALHLPG-AQGLPGADQCSVM 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex19NP_609547.2 Pex19 50..292 CDD:282470 89/262 (34%)
pex19NP_001017399.1 Pex19 64..288 CDD:282470 82/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587968
Domainoid 1 1.000 106 1.000 Domainoid score I6539
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134253
Inparanoid 1 1.050 124 1.000 Inparanoid score I4698
OMA 1 1.010 - - QHG59377
OrthoDB 1 1.010 - - D1282367at2759
OrthoFinder 1 1.000 - - FOG0004307
OrthoInspector 1 1.000 - - oto40018
orthoMCL 1 0.900 - - OOG6_103566
Panther 1 1.100 - - LDO PTHR12774
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.