DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex19 and Pex19

DIOPT Version :9

Sequence 1:NP_609547.2 Gene:Pex19 / 34630 FlyBaseID:FBgn0032407 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_075528.3 Gene:Pex19 / 19298 MGIID:1334458 Length:299 Species:Mus musculus


Alignment Length:301 Identity:91/301 - (30%)
Similarity:150/301 - (49%) Gaps:36/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELNDLLDSALQDFDKSGAGDQKEPSASSDVATNAGPE----GSEDPDAFFIEQAKVLADRMNTLF 70
            ||.:||:|||.||||:....:..|:.|:..|  :||:    |....||.|..|.|...:..::..
Mouse    17 ELEELLESALDDFDKAKPSPEHAPTISAPDA--SGPQKRAPGDTAKDALFASQEKFFQELFDSEL 79

  Fly    71 GGPDTPSGD--IPPLPQDPDQIMAGFKKMAEAAALTLSGENSATDEDVSKYSDSISQALKGLQEG 133
            ....|...:  :..|.::...::..|:|::|||...  |.::::.::   ::..:.:.|.||.:.
Mouse    80 ASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRV--GSDASSQQE---FTSCLKETLSGLAKN 139

  Fly   134 SENLA-APASENDIASMFGSLNLEGAG--EGDGN-MFLPFMEGMMQSLLSAEILLPSIRELLEKY 194
            :..|. :..||.::...     :||.|  ||||. ..||.|:.:||:|||.::|.||::|:.|||
Mouse   140 ATELQNSGMSEEELMKA-----MEGLGMDEGDGEASILPIMQSIMQNLLSKDVLYPSLKEITEKY 199

  Fly   195 PKYLEENDAKLSAEDKERYQKQMELYKVIEGHLQSEKTEDSAAVKREKFRVVLDDMRKLQDYGQP 259
            |::|:.:......|..|:||:|..:...|....::|...||.|.:|.:|..:||.|::||..|.|
Mouse   200 PEWLQSHQDSTPPEQFEKYQQQHSVMVKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHP 264

  Fly   260 PPEILAETGGDLPF--------GDPTAGVAAGGPGPQCPTM 292
            |.|:..|....|.|        |.|      |..|.||..|
Mouse   265 PKELAGEMPPGLNFDLDALNLSGPP------GANGEQCLIM 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex19NP_609547.2 Pex19 50..292 CDD:282470 73/255 (29%)
Pex19NP_075528.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61 18/47 (38%)
Necessary for PEX19 function on peroxisome biogenesis. /evidence=ECO:0000250 2..91 23/79 (29%)
Docking to the peroxisome membrane and binding to PEX3. /evidence=ECO:0000250 2..56 17/42 (40%)
Pex19 74..299 CDD:282470 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843066
Domainoid 1 1.000 100 1.000 Domainoid score I7042
eggNOG 1 0.900 - - E1_KOG3133
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134253
Inparanoid 1 1.050 124 1.000 Inparanoid score I4703
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59377
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004307
OrthoInspector 1 1.000 - - oto93812
orthoMCL 1 0.900 - - OOG6_103566
Panther 1 1.100 - - LDO PTHR12774
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.