DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex19 and LOC102548286

DIOPT Version :9

Sequence 1:NP_609547.2 Gene:Pex19 / 34630 FlyBaseID:FBgn0032407 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_017456640.1 Gene:LOC102548286 / 102548286 RGDID:7538513 Length:343 Species:Rattus norvegicus


Alignment Length:298 Identity:92/298 - (30%)
Similarity:153/298 - (51%) Gaps:30/298 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELNDLLDSALQDFDKSGAGDQKEPSASSDVATNAGPE----GSEDPDAFFIEQAKVLADRMNTLF 70
            ||.:||:|||.||||:.......|:.|:..|  :||:    |....||.|..|.|...:..::..
  Rat    61 ELEELLESALDDFDKAKPSPAPSPTISAPDA--SGPQKRSPGDTAKDALFASQEKFFQELFDSEL 123

  Fly    71 GGPDTPSGD--IPPLPQDPDQIMAGFKKMAEAAALTLSGENSATDEDVSKYSDSISQALKGLQEG 133
            ....|...:  :..|.::...::..|:|::|||...  |.::::.::   ::..:.:.|.||.:.
  Rat   124 ASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRV--GSDASSQQE---FTSCLKETLSGLAKN 183

  Fly   134 SENLA-APASENDIASMFGSLNLEGAGEGDGNMFLPFMEGMMQSLLSAEILLPSIRELLEKYPKY 197
            :.:|. |..||.::......|.:: .|:|:||: ||.|:.:||:|||.::|.||::|:.||||::
  Rat   184 ATDLQNAGMSEEELTKAMEGLGMD-EGDGEGNI-LPIMQSLMQNLLSKDVLYPSLKEITEKYPEW 246

  Fly   198 LEENDAKLSAEDKERYQKQMELYKVIEGHLQSEKTEDSAAVKREKFRVVLDDMRKLQDYGQPPPE 262
            |:.:...:..|..|:||:|..:...|....::|...||.|..|.:|..|||.|::|||.|.||.|
  Rat   247 LQSHQESIPPEQFEKYQQQHSVMGKICEQFEAETPTDSEATHRARFEAVLDLMQQLQDLGHPPKE 311

  Fly   263 ILAETGGDLPF--------GDPTAGVAAGGPGPQCPTM 292
            :..|....|.|        |.|      |..|.||..|
  Rat   312 LAGEMPPGLNFDLDALNLSGPP------GANGEQCLIM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex19NP_609547.2 Pex19 50..292 CDD:282470 74/252 (29%)
LOC102548286XP_017456640.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134253
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282367at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.