DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex19 and pex19

DIOPT Version :9

Sequence 1:NP_609547.2 Gene:Pex19 / 34630 FlyBaseID:FBgn0032407 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001120089.1 Gene:pex19 / 100145099 XenbaseID:XB-GENE-973478 Length:285 Species:Xenopus tropicalis


Alignment Length:305 Identity:99/305 - (32%)
Similarity:158/305 - (51%) Gaps:40/305 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EEKKNGDELNDLLDSALQDFDKSGAGDQKEPSASSDVATNAGPE---GSEDPDAFFIEQAKVLAD 64
            ||.|   ||::||||||.||:|:    .:.|.||:...|.:|||   |....||.|..|.:...:
 Frog     6 EEDK---ELDELLDSALDDFEKT----NQPPQASNTATTASGPEKPSGDAAKDALFTSQEQFFQE 63

  Fly    65 RMNTLFGGPDTPSGD--IPPLPQDPDQIMAGFKKMAEAAALTLSGENSATDEDVSKYSDSISQAL 127
            ..:|......|...:  :..|.::...::..|:|::|||....|.|.|.     .:::..:.:.|
 Frog    64 LFSTELAAQATQEFEKAMKELAEEEPHLVEQFQKLSEAAGKVGSDETSQ-----QEFTSCLKETL 123

  Fly   128 KGLQEGSENLA-APASENDIASMFGSLNLEGAGEGDGNMFLPFMEGMMQSLLSAEILLPSIRELL 191
            .||.:.::.|. :..||.::|.....|.::. ||||||: ||.|:.:||:|||.|:|.||::|:.
 Frog   124 SGLAKNADELQNSSLSEEELAKTMEGLGMDD-GEGDGNI-LPLMQNIMQNLLSKEVLYPSLKEIT 186

  Fly   192 EKYPKYLEENDAKLSAEDKERYQKQMELYKVIEGHLQSEKTEDSAAVKREKFRVVLDDMRKLQDY 256
            ||||::|..:...|.||:..:||:|    .::.|.:..:...:...::..:|..|:|.|::||:.
 Frog   187 EKYPEWLRTHRDSLPAEEYNKYQEQ----HILMGKICQQFELEQPGIEAARFEAVMDLMQQLQEL 247

  Fly   257 GQPPPEILAETGGDLPFG-----DPTAGVAAGGP----GPQCPTM 292
            |.||.|:    .||.|.|     |   ||...||    |.||..|
 Frog   248 GHPPKEL----AGDSPPGMNFDLD---GVNLAGPGSGNGEQCLIM 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex19NP_609547.2 Pex19 50..292 CDD:282470 76/253 (30%)
pex19NP_001120089.1 Pex19 64..285 CDD:368022 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I6503
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134253
Inparanoid 1 1.050 134 1.000 Inparanoid score I4465
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282367at2759
OrthoFinder 1 1.000 - - FOG0004307
OrthoInspector 1 1.000 - - oto104034
Panther 1 1.100 - - LDO PTHR12774
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.