DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and RAX2

DIOPT Version :10

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_116142.1 Gene:RAX2 / 84839 HGNCID:18286 Length:184 Species:Homo sapiens


Alignment Length:143 Identity:56/143 - (39%)
Similarity:72/143 - (50%) Gaps:31/143 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 ALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRKQH 272
            |.|:|.||.||||:..||.:||||||.:.|||:|:|||||.:.:|.|.|:||||.||||:.|:|.
Human    22 APKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQE 86

  Fly   273 TSVSGGAPGGAAASVSHVAASSSLPSVVSSVPSMAPLAM-----------------MPGSLDPAT 320
            ...||          |...|:..||. ..::|...|.||                 :|..|.|..
Human    87 RLESG----------SGAVAAPRLPE-APALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGP 140

  Fly   321 VYQQQYDFYGSHA 333
            ..|..   :|.||
Human   141 GLQAS---FGPHA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 34/55 (62%)
RAX2NP_116142.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 6/10 (60%)
Homeodomain 28..84 CDD:459649 34/55 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.