powered by:
Protein Alignment prd and MIXL1
DIOPT Version :9
Sequence 1: | NP_723721.1 |
Gene: | prd / 34629 |
FlyBaseID: | FBgn0003145 |
Length: | 613 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001269331.1 |
Gene: | MIXL1 / 83881 |
HGNCID: | 13363 |
Length: | 240 |
Species: | Homo sapiens |
Alignment Length: | 67 |
Identity: | 38/67 - (56%) |
Similarity: | 44/67 - (65%) |
Gaps: | 8/67 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 213 QRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARI--------QVWFSNRRARLR 269
|||.||:|||.||..||..|.||:||||:.||.||..|.|.|:|| ||||.||||:.|
Human 86 QRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQLLFSPLFQVWFQNRRAKSR 150
Fly 270 KQ 271
:|
Human 151 RQ 152
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
prd | NP_723721.1 |
PAX |
27..154 |
CDD:238076 |
|
Homeobox |
217..269 |
CDD:278475 |
33/59 (56%) |
MIXL1 | NP_001269331.1 |
Homeobox |
89..150 |
CDD:278475 |
33/60 (55%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0849 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000011 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.