DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and HB53

DIOPT Version :10

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_201471.1 Gene:HB53 / 836803 AraportID:AT5G66700 Length:228 Species:Arabidopsis thaliana


Alignment Length:122 Identity:28/122 - (22%)
Similarity:49/122 - (40%) Gaps:39/122 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 SDVSGGHHNNGKP---------------SDEDISDCESEPGIALKRKQRRCRTTFSASQLDELER 230
            :.:.||..:  ||               ::||:::.   .|:..|||       .:..|::.||.
plant    33 NQIDGGEES--KPVKRRRKRRSKGSSATNEEDVAEI---GGMLRKRK-------LTDEQVNMLEY 85

  Fly   231 AFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRAR------------LRKQHTSV 275
            :|......:...:|::|....|...::.|||.|||||            |:..|.:|
plant    86 SFGNEHKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKNKKLEEEYAKLKNHHDNV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 16/67 (24%)
HB53NP_201471.1 Homeodomain 71..125 CDD:459649 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.