DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and HAT1

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:176 Identity:47/176 - (26%)
Similarity:75/176 - (42%) Gaps:27/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SSP----GMFSW---------EIREKLIREGVCDRSTAPSVSAISRLVRGRDAPLDNDMSSASG- 166
            |||    .||.|         :.:::.:|:  .|.::.|:...:.. ..|..:|.....|:.|| 
plant    30 SSPMSNLQMFPWNQTLVSSSDQQKQQFLRK--IDVNSLPTTVDLEE-ETGVSSPNSTISSTVSGK 91

  Fly   167 --SPAGDGTKASSSCGSDVSGGHHNNGKPSDEDISDCESEPGIALKRKQRRCRTTFSASQLDELE 229
              |...:|| :...||.|:.   ....:.|....||.|.:.|....||:.|    .|..|...||
plant    92 RRSTEREGT-SGGGCGDDLD---ITLDRSSSRGTSDEEEDYGGETCRKKLR----LSKDQSAVLE 148

  Fly   230 RAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRKQHTSV 275
            ..|:.....:...:..||::..||..:::|||.|||||.:.:.|.|
plant   149 DTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTKLKQTEV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076 10/50 (20%)
Homeobox 217..269 CDD:278475 17/51 (33%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:282474 15/70 (21%)
HOX 134..188 CDD:197696 20/57 (35%)
HALZ 190..233 CDD:128634 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.