DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and Rhox13

DIOPT Version :10

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus


Alignment Length:160 Identity:50/160 - (31%)
Similarity:74/160 - (46%) Gaps:41/160 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 DNDMSSASGSPAGDGTKASSSCGSDVSGGHHNNGKPSDEDISDCE--SEPGIA------------ 208
            ::|..|.|.|       .|.|..||.|....::...||||.||.|  :.|.:|            
Mouse    67 ESDSESESDS-------ESESDSSDSSDESDDDSSTSDEDTSDPEEAAAPSVAAVAAAAAPPTVP 124

  Fly   209 -------------------LKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTE 254
                               ::|::|.....|:..|::|:|..||.|||||:.||.|||:..|:.|
Mouse   125 AAAAIQIPGPYRYRPPRRHVRRRRRGPPFHFAQWQVEEMESLFEETQYPDLLTRGELARTLNVPE 189

  Fly   255 ARIQVWFSNRRARLRK-QHTSVSGGAPGGA 283
            .:::|||:||||:.|| :...:....|.||
Mouse   190 VKVKVWFTNRRAKQRKIERREMLRNIPPGA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 26/55 (47%)
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114 18/53 (34%)
Homeodomain 155..205 CDD:459649 25/49 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.