DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and SDCBP

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001335270.1 Gene:SDCBP / 6386 HGNCID:10662 Length:319 Species:Homo sapiens


Alignment Length:248 Identity:54/248 - (21%)
Similarity:81/248 - (32%) Gaps:102/248 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 HVAASSSLPSVVSSVPSMAPLAMMPGSLDPATVYQQQYDFYGSHANISV--SAAAPMASSNLSPG 351
            |:......|:.:|..||:..|.:       ..|.|.|..|..:.||.::  .|:||:        
Human    11 HIIVMVKNPAKMSLYPSLEDLKV-------DKVIQAQTAFSANPANPAILSEASAPI-------- 60

  Fly   352 ITTTPPHHHQFYNPSANTASYIMPGENGNTTPTGNIIVSSYETQLGSVYGTETETHQTMPRNES- 415
                 ||                   :||..|              .:| .|...:..:..||. 
Human    61 -----PH-------------------DGNLYP--------------RLY-PELSQYMGLSLNEEE 86

  Fly   416 --PNESVSSAF---GQLPPTPNSLSAVVSGAGVTSSSGANSGADPSQSLANASAGSEEL------ 469
              .|.:|.|..   |||...|:|::.:|  |.||       |.|.....|....|..|:      
Human    87 IRANVAVVSGAPLQGQLVARPSSINYMV--APVT-------GNDVGIRRAEIKQGIREVILCKDQ 142

  Fly   470 --SAALKVESVD------LIAA-SQSQLYG----------------GWSSMQA 497
              ...|:::|:|      |:.| |.:.|.|                ||||.:|
Human   143 DGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKA 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475
SDCBPNP_001335270.1 PDZ_signaling 133..212 CDD:238492 14/63 (22%)
PDZ_signaling 217..290 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.