DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and pax2b

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_571715.1 Gene:pax2b / 60638 ZFINID:ZDB-GENE-001030-4 Length:386 Species:Danio rerio


Alignment Length:438 Identity:151/438 - (34%)
Similarity:205/438 - (46%) Gaps:131/438 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVS 72
            :||||               .|.||||||||:||||||:.:|.:|||:|..|:|||.||||||||
Zfish    11 SAMHR---------------HGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVS 60

  Fly    73 HGCVSKILNRYQETGSIRPGVIGGSKPRIATPEIENRIEEYKRSSPGMFSWEIREKLIREGVCDR 137
            ||||||||.||.|||||:|||||||||::|||::.::|.:|||.:|.||:||||::|:.||:||.
Zfish    61 HGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIADYKRQNPTMFAWEIRDRLLAEGICDN 125

  Fly   138 STAPSVSAISRLVRGR-DAPLDNDMSSASGSPAGDGTKAS---------------SSCGSDVSGG 186
            .|.||||:|:|::|.: ..|.         .|:.|||..|               ||..:|..|.
Zfish   126 DTVPSVSSINRIIRTKVQQPF---------HPSPDGTSLSTPGHTIIPSTASPPVSSSSNDPVGS 181

  Fly   187 HHNNG-----------KPSDEDISD-----CESEPGIALKRKQRRCRTTFSASQLDELERAFERT 235
            :..||           :..|.|.|:     .:|:..:...||..|. ..|:..||:.|:|.|||.
Zfish   182 YSINGILGIPRSNGEKRKRDADGSEGSAQSSDSQGSVESLRKHLRA-DAFTQQQLEALDRVFERP 245

  Fly   236 QYPDIY-TREEL-----------AQRTNLTEARIQVWFSNRRARLRKQHTSVSGGAPGGAAASVS 288
            .:||:: |.|.:           |..|.|.|.:                .|:|..|.....||||
Zfish   246 AFPDVFPTSEHIKPEQASEYSLPALNTGLDEVK----------------PSLSSSAASDLGASVS 294

  Fly   289 HV------AASSSLPSV--------VSSVPSMAPLAMMPGSLDPATVYQQQYDFYG---SHANIS 336
            ..      .|:::||..        ..|.|:.....|:|||           :|.|   ||... 
Zfish   295 QSYPVGRDMANTTLPGYPPHVPPTGQGSYPTSTLAGMVPGS-----------EFSGNPYSHPQY- 347

  Fly   337 VSAAAPMASSNLSPGITTTPPHHHQFYNPSANTASYIMPGENGNTTPT 384
                             ||.....:|.||:..::.|......|:..||
Zfish   348 -----------------TTYNEAWRFSNPAILSSPYYYSASRGSAPPT 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076 83/127 (65%)
Homeobox 217..269 CDD:278475 16/63 (25%)
pax2bNP_571715.1 PAX 15..139 CDD:128645 83/138 (60%)
Pax2_C 290..384 CDD:289189 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.