DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and mxtx2

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001073284.1 Gene:mxtx2 / 58078 ZFINID:ZDB-GENE-000710-6 Length:296 Species:Danio rerio


Alignment Length:355 Identity:90/355 - (25%)
Similarity:127/355 - (35%) Gaps:103/355 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 SDCESEPG--IALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWF 261
            :||.::.|  .|.|...||.||:|:...|:.|:.||....||.|..||.|:|.|.|.|:||||||
Zfish     6 TDCIAQDGNSQASKIAGRRKRTSFTKEHLELLKMAFNVDPYPGISVRESLSQATGLPESRIQVWF 70

  Fly   262 SNRRARLRKQHTSVSGGAPGGAAASVSHVAASSSLPSVVSSVPSMAPLAMMPGSLDPATVYQQQY 326
            .|:|||..|..                   |..|.|.:.:..|..:|  .:|..:....|..||.
Zfish    71 QNKRARTLKNR-------------------AIQSSPQLDNKSPLPSP--FLPPHMASVGVSAQQR 114

  Fly   327 DFYGSHANISVSAAAP----------------------MASSNLSPG-ITTTPPHHHQFYNPSAN 368
            ....|..||.:|..:|                      |.:|:.||. :..||.......:...:
Zfish   115 GIQESPFNIQMSQTSPQHFTFPPSDYSTPVVKPRQTRLMGTSSCSPSDLQATPDSWSYAGSTQIS 179

  Fly   369 TASYIMPGEN-GNTTPTGNIIVSSYETQLGSVYGTETETHQTMPRNESPNESVSSAFGQLPPTPN 432
            ..|:.:..|| ||          ||                   ::|||       |...||.|.
Zfish   180 PESWDVAAENFGN----------SY-------------------KDESP-------FFLYPPPPY 208

  Fly   433 SLSAVVSGAGVTSSSGANSGADPSQSLANASAGSEELSAALKVESVDLIAASQSQLYGGWSSMQA 497
            ...:  :..|..||..:.|.:..|...|....|.|..|.::...|..          ..|..:..
Zfish   209 PYGS--TRVGCPSSMESLSTSPASSDSAFWDMGLENCSPSVPYTSCG----------SPWDRLTE 261

  Fly   498 LRPNAPLSPEDSLNSTSSTSQALDVTAHQM 527
            .:|.||| |:.|       ||.|:....:|
Zfish   262 EQPVAPL-PDLS-------SQCLEDVLGEM 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475 27/51 (53%)
mxtx2NP_001073284.1 HOX 22..76 CDD:197696 27/53 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.