DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and gsc

DIOPT Version :10

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001016704.1 Gene:gsc / 549458 XenbaseID:XB-GENE-486771 Length:243 Species:Xenopus tropicalis


Alignment Length:66 Identity:34/66 - (51%)
Similarity:49/66 - (74%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 RKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRKQHTSV 275
            |::||.||.|:..||:.||..|:.|:|||:.|||:||:|.:|.|.:::|||.||||:.|:|..|.
 Frog   146 RRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARRVHLREEKVEVWFKNRRAKWRRQKRSS 210

  Fly   276 S 276
            |
 Frog   211 S 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 29/55 (53%)
gscNP_001016704.1 Homeodomain 149..205 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.