DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and PAX9

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001359005.1 Gene:PAX9 / 5083 HGNCID:8623 Length:341 Species:Homo sapiens


Alignment Length:366 Identity:125/366 - (34%)
Similarity:170/366 - (46%) Gaps:82/366 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MNSGQGRVNQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNRYQETGS 88
            |....|.||||||||:|||||||.|||:|||:|..|||||.||||||||||||||||.||.||||
Human     1 MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGS 65

  Fly    89 IRPGVIGGSKPRIATPEIENRIEEYKRSSPGMFSWEIREKLIREGVCDRSTAPSVSAISRLVRGR 153
            |.||.|||||||:.||.:...|..||:..||:|:||||::|:.:||||:...||||:|||::|.:
Human    66 ILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNK 130

  Fly   154 DAPLDNDMSSASGSPAGDGTKASSSCGSDVSGGHHNNGK--------------------PSDEDI 198
                                     .|:....||:::.|                    |.....
Human   131 -------------------------IGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAA 170

  Fly   199 SDCESEPGI-ALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFS 262
            :...:.||: |:.......||..|:..:.::......|        ::::..:.....:::.|.|
Human   171 AKVPTPPGVPAIPGSVAMPRTWPSSHSVTDILGIRSIT--------DQVSDSSPYHSPKVEEWSS 227

  Fly   263 NRRARL--RKQHTSVSGGAPGGAAASVSHVAASSSLPSVVS--SVPSMAPLAMMPGSLDPATVYQ 323
            ..|...  ...| :|:|...|.......:..|.:.||:|.|  |..||||.. .|..:.|...|.
Human   228 LGRNNFPAAAPH-AVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYP-TPAQVSPYMTYS 290

  Fly   324 QQYDFY-----GSHANISVSAAAPMASSNLSPGITTTPPHH 359
            .....|     ..||                 |.|:..||:
Human   291 AAPSGYVAGHGWQHA-----------------GGTSLSPHN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076 85/126 (67%)
Homeobox 217..269 CDD:278475 7/53 (13%)
PAX9NP_001359005.1 PAX 6..131 CDD:238076 85/149 (57%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 7..63 45/55 (82%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 82..130 23/47 (49%)
Interaction with KDM5B. /evidence=ECO:0000269|PubMed:12657635 168..189 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.