DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and repo

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster


Alignment Length:395 Identity:117/395 - (29%)
Similarity:173/395 - (43%) Gaps:72/395 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 TAPSVSAISRLVRGRDAPLDNDMSSASGSPAGDGTKASSSCGSDVSGGHHNNGKPSDEDISDCES 203
            |.||.|  |.:|.|......|..||:|   ||.|.:.::.    .:||........|...|..:.
  Fly   242 TPPSSS--STVVNGTTNGTGNANSSSS---AGVGIQGAAG----TAGGVAAPAAKKDGSSSKKKG 297

  Fly   204 EP-GIALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRAR 267
            :| ||    |:::.||||:|.||:||||||||..|||::.|||||.:.||:|:|:||||.||||:
  Fly   298 DPNGI----KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAK 358

  Fly   268 LRKQHTS-----VSGGAPGGAAASVSHVAAS-SSLPSVVSSVPSMAPLAMMPGSLDPATVYQQQY 326
            .||....     :....|..|..:...:|.. :|.|...:..|        |||:|..|.||..|
  Fly   359 WRKHEPPRKTGYIKTSTPPTATLNPGTLAPPFTSYPQTTTVTP--------PGSMDSWTSYQTPY 415

  Fly   327 DFYGSHANISVSAAAPMASSNLSPGI-----TTTPPHHHQFYNPS-----ANTASYIMPGE---- 377
            :.....:.:| .||:|..:.:...|.     ...|..|:::.:|:     |.|.|....|:    
  Fly   416 ELTPQFSLLS-PAASPYGTYSGQYGAYVHESQLFPMRHYEYGSPTRMEMGATTGSVAGNGDESVA 479

  Fly   378 NGNTTPTGNIIVSSYETQLGSVYGTETETH---QTMPRNESPNESVSSA-------------FGQ 426
            ||.:..|.. :.::.:.||..  ||....|   |...:.:..|....||             .|.
  Fly   480 NGGSYQTAE-LQTAQQQQLAD--GTLVTVHAHQQQQQQQQQLNGKYLSAEEAKYVHLQCHQSGGG 541

  Fly   427 LPPTPNSLSAVVSGAG---VTSSSGANSGADPSQSLANASAGSEELSAALKVESVDLIAASQSQL 488
            |..:|.:...:|...|   ||:::|..:.|..:.|..|.|.|   :...:|.|.|    :.|.|.
  Fly   542 LELSPGASCHLVEAQGQHYVTTATGGAASAGGTSSDDNDSGG---MQTVIKSEEV----SQQQQQ 599

  Fly   489 YGGWS 493
            ..|.|
  Fly   600 QQGQS 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076 7/14 (50%)
Homeobox 217..269 CDD:278475 35/51 (69%)
repoNP_477026.1 Homeobox 313..360 CDD:278475 31/46 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450990
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.