DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and Dr

DIOPT Version :10

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster


Alignment Length:105 Identity:33/105 - (31%)
Similarity:48/105 - (45%) Gaps:15/105 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 DCESEPGIALK----RKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVW 260
            |....|.|...    :..|:.||.|:..||..||:.|...||..|..|.|.:....|||.::::|
  Fly   404 DANEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIW 468

  Fly   261 FSNRRARLRK---------QHTSVSGGAPGG--AAASVSH 289
            |.||||:.::         :..::..||||.  |.|...|
  Fly   469 FQNRRAKAKRLQEAEIEKIKMAALGRGAPGAQWAMAGYFH 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 23/55 (42%)
DrNP_477324.1 Homeodomain 422..478 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.