| Sequence 1: | NP_723721.1 | Gene: | prd / 34629 | FlyBaseID: | FBgn0003145 | Length: | 613 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_524521.1 | Gene: | ro / 43234 | FlyBaseID: | FBgn0003267 | Length: | 350 | Species: | Drosophila melanogaster |
| Alignment Length: | 141 | Identity: | 49/141 - (34%) |
|---|---|---|---|
| Similarity: | 62/141 - (43%) | Gaps: | 31/141 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 191 GKPSDEDISDCESEPGIALKRK---QRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNL 252
Fly 253 TEARIQVWFSNRRA---RLRK----QH--------------------TSVSGGAPGGAAASVS-H 289
Fly 290 VAASSSLPSVV 300 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| prd | NP_723721.1 | PAX | 27..154 | CDD:238076 | |
| Homeodomain | 214..270 | CDD:459649 | 28/58 (48%) | ||
| ro | NP_524521.1 | Homeodomain | 196..248 | CDD:459649 | 24/51 (47%) |
| Blue background indicates that the domain is not in the aligned region. | |||||