DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and abd-A

DIOPT Version :10

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster


Alignment Length:135 Identity:37/135 - (27%)
Similarity:56/135 - (41%) Gaps:21/135 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 MSSASGSPAGDGTKASSSCGSDVSGGHHNNGKPSDEDISDCESEPGIALKR-------------- 211
            :|:||....|..: ..::|....||.....|......|:|....|.:.|..              
  Fly   327 VSAASAGAIGVDS-LGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDF 390

  Fly   212 ------KQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRK 270
                  .:||.|.|::..|..|||:.|....|.....|.|:|....|||.:|::||.|||.:|:|
  Fly   391 NGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455

  Fly   271 QHTSV 275
            :..:|
  Fly   456 ELRAV 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 23/55 (42%)
abd-ANP_732176.1 Homeodomain 399..455 CDD:459649 23/55 (42%)
Abdominal-A 456..478 CDD:403567 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.