DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and si:dkey-43p13.5

DIOPT Version :10

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_068074401.2 Gene:si:dkey-43p13.5 / 407678 ZFINID:ZDB-GENE-131121-510 Length:285 Species:Danio rerio


Alignment Length:121 Identity:49/121 - (40%)
Similarity:68/121 - (56%) Gaps:10/121 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 HHNNGKPSDEDISDCESEPGIALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTN 251
            |.::|.|:|.     ..||...   ||||.|..:|:.||:|||:.|:.|.||||:.||.||.|.:
Zfish    93 HPSSGHPADN-----IDEPRPV---KQRRARANYSSWQLEELEKTFQSTHYPDIFMREALALRLD 149

  Fly   252 LTEARIQVWFSNRRARLRKQ-HTSVSGGAP-GGAAASVSHVAASSSLPSVVSSVPS 305
            |.|||:||||.||||::|:| ...:..|.. ........|..:|.|.|.:.::.||
Zfish   150 LIEARVQVWFQNRRAKMRRQLKLQIQTGEQCSQRDTDTRHPESSISNPELHNNSPS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 32/55 (58%)
si:dkey-43p13.5XP_068074401.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.