DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and CG9876

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:279 Identity:87/279 - (31%)
Similarity:121/279 - (43%) Gaps:61/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 ILNRYQETGSI---RPG------VIGG---SKPRIATPEIENRIEEYKRSSPGMFSWEIREKLIR 131
            :||..|:..|:   .||      .:.|   |..:....|.|:::|:.:.|...:      :|:.|
  Fly     1 MLNYQQQLHSLPVGNPGNFYYGPTVSGEIYSSHQSHNLESEDKLEDREESGRNL------DKIHR 59

  Fly   132 EGVCDRSTAPSVSAISRLVRGRDAPLDNDMSSASGSPAG---DGTKASSSCGSDV--SGGHHNNG 191
            ..| |........|.|   :|:.|   .::||..| |.|   .|....:.|..::  .||||:  
  Fly    60 FSV-DNIMEMKHDAYS---KGKMA---MELSSNFG-PTGAGCGGADRPAPCSGNLPAGGGHHS-- 114

  Fly   192 KPSDEDISDCESEPGIALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEAR 256
                               ||.||.|||||::||..||:.||||.|||.:.|||||.:.:|:|||
  Fly   115 -------------------RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEAR 160

  Fly   257 IQVWFSNRRARLRKQHTSVSG-----GAPGGAAASVS---HVAASSSLPSVVSSVPSMA-PLAMM 312
            :||||.||||:.|:...||..     .||....|.:|   |..|:...|......|..| .|...
  Fly   161 VQVWFQNRRAKFRRNERSVGSRTLLDTAPQLVPAPISNNMHKYANMPHPHPQPPPPPGAYALNFG 225

  Fly   313 PGSLDPATVYQQQYDFYGS 331
            |..|.....|...|..:||
  Fly   226 PLELRSCQNYTNCYGGFGS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076 19/86 (22%)
Homeobox 217..269 CDD:278475 33/51 (65%)
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450900
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.