DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and sdcbp2

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_997856.1 Gene:sdcbp2 / 325004 ZFINID:ZDB-GENE-030131-3727 Length:299 Species:Danio rerio


Alignment Length:232 Identity:44/232 - (18%)
Similarity:67/232 - (28%) Gaps:91/232 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 ASSNLSPGITTTPPHHHQFYNPSANTASYIMPGENGNTTPTGNIIVSSYETQLGSVYGTETETHQ 408
            |.|..:...::||......|.|...|..  ||    ::|...|:      .:||...|....:.:
Zfish    18 AQSQFANATSSTPAITQGAYQPQPATQG--MP----SSTLYPNL------EELGDYMGLSLNSDE 70

  Fly   409 TMPRNESPNESVSSAFGQLPPTPNSLSAVVSGAGVTSSSGAN----SGADPSQSLANASAGSEEL 469
             :.||                  .:|..|.:...|.||.|..    :|||.....|....|..|:
Zfish    71 -VQRN------------------LALVPVATQVAVPSSVGGMVRPVTGADMGIRRAEIRPGLREV 116

  Fly   470 --------SAALKVESVD------LIAAS-----------------QSQLYGGWSSMQALRPNAP 503
                    ...|::..:|      |:.|:                 ..|...||:|.:|      
Zfish   117 ILCKDQEGKVGLRLRDIDNGVFVQLVQANSPAALAGLRFGDQVLQINGQNVAGWNSDKA------ 175

  Fly   504 LSPEDSLNSTSSTSQALDVTAHQMF------HPYQHT 534
                         .:||...|.|..      .|:|.|
Zfish   176 -------------HKALKAAAEQRIELIVRDRPFQRT 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475
sdcbp2NP_997856.1 PDZ_signaling 113..>173 CDD:238492 8/59 (14%)
PDZ_signaling 198..270 CDD:238492 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.