Sequence 1: | NP_723721.1 | Gene: | prd / 34629 | FlyBaseID: | FBgn0003145 | Length: | 613 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997856.1 | Gene: | sdcbp2 / 325004 | ZFINID: | ZDB-GENE-030131-3727 | Length: | 299 | Species: | Danio rerio |
Alignment Length: | 232 | Identity: | 44/232 - (18%) |
---|---|---|---|
Similarity: | 67/232 - (28%) | Gaps: | 91/232 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 344 ASSNLSPGITTTPPHHHQFYNPSANTASYIMPGENGNTTPTGNIIVSSYETQLGSVYGTETETHQ 408
Fly 409 TMPRNESPNESVSSAFGQLPPTPNSLSAVVSGAGVTSSSGAN----SGADPSQSLANASAGSEEL 469
Fly 470 --------SAALKVESVD------LIAAS-----------------QSQLYGGWSSMQALRPNAP 503
Fly 504 LSPEDSLNSTSSTSQALDVTAHQMF------HPYQHT 534 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
prd | NP_723721.1 | PAX | 27..154 | CDD:238076 | |
Homeobox | 217..269 | CDD:278475 | |||
sdcbp2 | NP_997856.1 | PDZ_signaling | 113..>173 | CDD:238492 | 8/59 (14%) |
PDZ_signaling | 198..270 | CDD:238492 | 1/2 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0849 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |