DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and dharma

DIOPT Version :10

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_571054.1 Gene:dharma / 30170 ZFINID:ZDB-GENE-990415-22 Length:192 Species:Danio rerio


Alignment Length:87 Identity:38/87 - (43%)
Similarity:54/87 - (62%) Gaps:5/87 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GKPSDEDISDCESEPG----IALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTN 251
            |:|....::.||:...    || :|.:.|.||.|:.:|.::|||.|..|.||.:.||.||||.|.
Zfish    90 GQPWPYAVAGCETAENHYHTIA-QRPRGRIRTVFTDNQTEQLERLFAVTDYPTVETRAELAQNTG 153

  Fly   252 LTEARIQVWFSNRRARLRKQHT 273
            |:|..::|||.|||||.::|.|
Zfish   154 LSEETVRVWFKNRRARRKRQTT 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 29/55 (53%)
dharmaNP_571054.1 Homeodomain 117..172 CDD:459649 29/54 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.