DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and Mixl1

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001099449.1 Gene:Mixl1 / 289311 RGDID:1310011 Length:231 Species:Rattus norvegicus


Alignment Length:169 Identity:58/169 - (34%)
Similarity:71/169 - (42%) Gaps:50/169 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PLDNDMSSASGSPA----GDGTKASSSCGSDVSGGHHNNGKPSDEDISDCESEPGIALKRKQRRC 216
            |...|..:.:.:|.    |....|.:..|.|..|....:..||                ..|||.
  Rat    41 PAPPDSRAPAATPCFPSRGPRPAAQTPTGLDPPGPSKGSAAPS----------------APQRRK 89

  Fly   217 RTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRKQHTSVSG---- 277
            ||:||:.||..||..|.:|.||||:.||.||..|.|.|:||||||.||||:.|:|    ||    
  Rat    90 RTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQ----SGKSFQ 150

  Fly   278 ------------GAPGGAA----------ASVSHVAASS 294
                        .|||..|          |.|:||..||
  Rat   151 PLSSRREDFLHRPAPGTEARCLKPQLPLEADVNHVLDSS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475 31/51 (61%)
Mixl1NP_001099449.1 PRK14971 <2..139 CDD:237874 42/113 (37%)
Homeobox 89..143 CDD:395001 31/53 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.