DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and sebox

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001306981.1 Gene:sebox / 282666 ZFINID:ZDB-GENE-021206-4 Length:293 Species:Danio rerio


Alignment Length:319 Identity:85/319 - (26%)
Similarity:117/319 - (36%) Gaps:113/319 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 KQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRKQH---T 273
            :::|.||.||.:||.||||||..|.||||..||.||..|.|.|::|||||.|||||..|..   |
Zfish    57 QRKRKRTIFSRAQLSELERAFMITPYPDITLRERLAALTLLPESKIQVWFQNRRARSMKSKKLIT 121

  Fly   274 SVSGGAPGGAAASVSHVAASSSLPSVVSSVPSMAPLAMMPGSLDPATVYQQQYDFYGSHANISVS 338
            .||..:|          |...:.|:                                :|.::::.
Zfish   122 PVSRRSP----------AKDCTFPA--------------------------------THPDLNLE 144

  Fly   339 AAAPMASSNLSPGITTTPPHH-----HQFYNPSANTASYIMPGENGNTTPTGNIIVSSYETQLGS 398
             .:|.|:.:|.        ||     .|..||.......|.|     ..|               
Zfish   145 -QSPEANKSLR--------HHQQSLIRQALNPWPQNRPPISP-----DLP--------------- 180

  Fly   399 VYGTETETHQTMPRN-ESPNESVSSAFGQLP------PTPNSLSAVVSGAGVTSSSGANSGADPS 456
                  |..|...|| |:|.:   |:|...|      |.||..|:|..         .|..|...
Zfish   181 ------EILQWANRNSETPGD---SSFSSCPSERIQHPFPNQSSSVWQ---------MNCFAAHP 227

  Fly   457 QSLANASAGSEELSAALKVESVDLIAASQSQLYGGWSSMQALRPNAPLS-PEDSLNSTS 514
            :.|.:....|:.|.:::.|:  .:|.|..|.|      .:||:..|... |:.||...|
Zfish   228 EGLKSYCTTSQALYSSVSVD--QMIPAHPSSL------EEALQRQALTHYPQTSLGDIS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475 34/51 (67%)
seboxNP_001306981.1 COG5576 13..159 CDD:227863 48/152 (32%)
Homeobox 61..112 CDD:278475 32/50 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..144 7/68 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.