DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and Gm4981

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001030041.1 Gene:Gm4981 / 245263 MGIID:3645498 Length:291 Species:Mus musculus


Alignment Length:349 Identity:77/349 - (22%)
Similarity:111/349 - (31%) Gaps:115/349 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRKQ-- 271
            ::...||..|..:.||...|.:||||...|...||||||..|.|.|..|..|..|:|||..::  
Mouse     1 MRSSSRRPHTGLTLSQRRILAQAFERNPRPGCATREELALETGLPEDMIHTWLKNKRARRHRRGR 65

  Fly   272 ---------HTSVSGGAPGGAAASVSHVAASSSLPSVVSSVPSMAPLAMMPGSLDPATVYQQQYD 327
                     .:.||||||.|.......||..||||...:.                         
Mouse    66 PTAQDQDLLASQVSGGAPAGPVGRGHEVAQESSLPQEEAG------------------------- 105

  Fly   328 FYGSHANISVSAAAPMASSNLSPGITTTPPHHHQFYNPSANTASYI-------------MPGENG 379
                                 |.|:.||...    |:||....|.:             :|.:.|
Mouse   106 ---------------------STGMDTTSTS----YSPSFCRESQLSQVSQPRGAGQKEVPTQAG 145

  Fly   380 NTTPTGNIIVSSYETQ------------LGSVYGTETETHQTMPRNESPNESVSSAF-GQLPPTP 431
            |..|. .:::...:.:            |||..|.. |...:....:|.:|:.:|.: ..:|...
Mouse   146 NVGPL-ELLLDELQDEVQVKEHVPDPLDLGSDPGAR-EPEGSQDSLQSLDEAANSGWHTSVPSIS 208

  Fly   432 NSLSAVVSGAGVTSSSGANSGADPSQS------------LANASAGSEELSAALKVESVDLIAAS 484
            ::|......:.|...||......|:||            |.......|:..|.:.||..      
Mouse   209 STLCRESQPSQVAQPSGPGQAQAPTQSGFIDPLELFLDELLTEVQLEEQGPAPVNVEET------ 267

  Fly   485 QSQLYGGWSSMQALRPNAPLSPED 508
                    .......|..||:||:
Mouse   268 --------GEQMDTTPELPLTPEE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475 24/51 (47%)
Gm4981NP_001030041.1 homeodomain 6..56 CDD:238039 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.