DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and Pax5

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_032808.1 Gene:Pax5 / 18507 MGIID:97489 Length:391 Species:Mus musculus


Alignment Length:391 Identity:151/391 - (38%)
Similarity:209/391 - (53%) Gaps:54/391 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNR 82
            |.|.:.:.:|.|.||||||||:||||||:.:|.:|||:|..|:|||.||||||||||||||||.|
Mouse     7 YPTPRTIRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGR 71

  Fly    83 YQETGSIRPGVIGGSKPRIATPEIENRIEEYKRSSPGMFSWEIREKLIREGVCDRSTAPSVSAIS 147
            |.|||||:|||||||||::|||::..:|.||||.:|.||:||||::|:.|.|||..|.||||:|:
Mouse    72 YYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSIN 136

  Fly   148 RLVRGR-DAPLDNDMSSASGSPAGDGTKAS-SSCGSDVSGGHHN--------------NGKPSDE 196
            |::|.: ..|.:..:.::|.|....|:... ||..:|.:|..::              |.:..||
Mouse   137 RIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDE 201

  Fly   197 DISDC-----ESEPGIALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTE-- 254
            .|.:.     .|.||....|||.| ...|:..||:.|:|.|||..|.||:|..|..:....||  
Mouse   202 GIQESPVPNGHSLPGRDFLRKQMR-GDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYS 265

  Fly   255 --ARIQVWFSNRRARLRK-QHTSVSGGAPGGAAASV--SHVAASSSLPSVVSSVPS------MAP 308
              |.:.....:.:|.|.. ....:....||..:..:  ....||::||.....||.      .||
Mouse   266 AMASLAGGLDDMKANLTSPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAP 330

  Fly   309 --LAMMPGSLDPATVYQQ-QYDFYGSHANISVSAAAPMASSNLSPGITTTPPHHHQFYNPSANTA 370
              ..|:|||....:.|.. ||..|..      |...|      :||:..:|    .:|:|:|..|
Mouse   331 TLTGMVPGSEFSGSPYSHPQYSSYND------SWRFP------NPGLLGSP----YYYSPAARGA 379

  Fly   371 S 371
            :
Mouse   380 A 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076 85/127 (67%)
Homeobox 217..269 CDD:278475 17/55 (31%)
Pax5NP_032808.1 PAX 16..140 CDD:128645 84/123 (68%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 19..75 41/55 (75%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 94..142 25/47 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..218 7/35 (20%)
Pax2_C 285..389 CDD:289189 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.