DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and pax-3

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_496189.2 Gene:pax-3 / 185022 WormBaseID:WBGene00003939 Length:308 Species:Caenorhabditis elegans


Alignment Length:340 Identity:133/340 - (39%)
Similarity:174/340 - (51%) Gaps:63/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GQGRVNQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNRYQETGSIRP 91
            |||||||||||||||||||.::|..|:.||..||:||.|||||:||||.||||||||.|||||.|
 Worm    13 GQGRVNQLGGVFINGRPLPIHVRHAIISMAKKGIKPCHISRQLKVSHGAVSKILNRYAETGSISP 77

  Fly    92 GVIGGS-KPRIATPEIENRIEEYKRSSPGMFSWEIREKLIREGVCDRSTAPSVSAISRLV--RGR 153
            |.|||| :.|:....:|..|......:|.|.:.|:|:.||.:.:|.:..||:|.||.||:  :|.
 Worm    78 GQIGGSPRARLTVQAVEKEILIACDENPQMSAAELRDWLIHKDICTKGNAPTVPAIKRLIGNKGV 142

  Fly   154 DAP-------LDNDMSSASGSPAGDGTKASSSCGSDVSGGHHNNGKPSDEDISDCESEPGIALKR 211
            ..|       |...:.|..|....:.:|:||   .|..|...:|...|                 
 Worm   143 GVPKKMERKRLSYSIDSILGISIDECSKSSS---DDEEGSSPSNDASS----------------- 187

  Fly   212 KQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRK-----Q 271
              ||.||:|:|.|||.||.||....||....||.:::.|.|:|.:|..||||||||.||     |
 Worm   188 --RRNRTSFTAEQLDVLENAFRADTYPHANARESISKETGLSEEKIMTWFSNRRARCRKNMPMYQ 250

  Fly   272 HTSVSGGAPGGAAASVSHVAASSSLPSVVSSVPSMAPLAMMPG-SLDPATVYQQQYDFYGSHANI 335
            ..:|.|              ..||.||..:.:||  |:..:|. |..|     |....:..|   
 Worm   251 QYNVQG--------------FGSSPPSYPTLLPS--PMMFLPSYSTSP-----QLNPLFFQH--- 291

  Fly   336 SVSAAAPMASSNLSP 350
             :..::|.:|.:..|
 Worm   292 -ILQSSPPSSQSSPP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076 73/129 (57%)
Homeobox 217..269 CDD:278475 27/51 (53%)
pax-3NP_496189.2 PAX 13..141 CDD:238076 72/127 (57%)
HOX 187..243 CDD:197696 30/74 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.