powered by:
Protein Alignment prd and npax-4
DIOPT Version :9
Sequence 1: | NP_723721.1 |
Gene: | prd / 34629 |
FlyBaseID: | FBgn0003145 |
Length: | 613 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001255346.1 |
Gene: | npax-4 / 182466 |
WormBaseID: | WBGene00007496 |
Length: | 202 |
Species: | Caenorhabditis elegans |
Alignment Length: | 58 |
Identity: | 28/58 - (48%) |
Similarity: | 38/58 - (65%) |
Gaps: | 0/58 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 NQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNRYQETGSI 89
|:.|..:|:||||....|.||||....|::...|::||.::|.||||:|.||.|||.|
Worm 80 NRYGRPYISGRPLLTCDRQKIVECYKKGMKKIHIAKQLGITHSCVSKVLRRYAETGEI 137
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
prd | NP_723721.1 |
PAX |
27..154 |
CDD:238076 |
28/58 (48%) |
Homeobox |
217..269 |
CDD:278475 |
|
npax-4 | NP_001255346.1 |
HTH |
79..>142 |
CDD:389747 |
28/58 (48%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000011 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.