DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and egl-38

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_501836.1 Gene:egl-38 / 177876 WormBaseID:WBGene00001204 Length:289 Species:Caenorhabditis elegans


Alignment Length:221 Identity:96/221 - (43%)
Similarity:127/221 - (57%) Gaps:29/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PFFNGYSTMQ-DMNSGQGR---VNQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVSH 73
            |.:.|:...| |.....|.   ||||||||:|||||.:.:|.:||||:..|.|||.|||||:|||
 Worm    11 PTYPGHHNFQFDPLLSDGSHTGVNQLGGVFVNGRPLADTVRAQIVEMSQHGTRPCDISRQLKVSH 75

  Fly    74 GCVSKILNRYQETGSIRPGVIGGSKPRIATPEIENRIEEYKRSSPGMFSWEIREKLIREGVCDRS 138
            |||||||.||..|||:||||||||||::|||.:...|..|||::|.||:||||:|||.:.:|...
 Worm    76 GCVSKILGRYYSTGSVRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEE 140

  Fly   139 TAPSVSAISRLVRGRDAPLDNDMSSASGSPAGDGTKASSSCGSDVSGGHHNNGKPSDEDISDCES 203
            ..||||:|:|:||.:         |.....|...:..||:.....:..||....|.         
 Worm   141 NVPSVSSINRIVRNK---------SFMAQLAAPTSVTSSAARPSSATSHHQRSPPR--------- 187

  Fly   204 EPGIALKRKQRRCRTTFSASQLDELE 229
              |:     |:..:.:.|..||.:|:
 Worm   188 --GV-----QQHMQQSTSVQQLQQLQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076 79/129 (61%)
Homeobox 217..269 CDD:278475 4/13 (31%)
egl-38NP_501836.1 PAX 29..153 CDD:128645 76/123 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.