DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and GSC

DIOPT Version :10

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_776248.1 Gene:GSC / 145258 HGNCID:4612 Length:257 Species:Homo sapiens


Alignment Length:66 Identity:33/66 - (50%)
Similarity:49/66 - (74%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 RKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRKQHTSV 275
            |::||.||.|:..||:.||..|:.|:|||:.|||:||::.:|.|.:::|||.||||:.|:|..|.
Human   158 RRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSS 222

  Fly   276 S 276
            |
Human   223 S 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 28/55 (51%)
GSCNP_776248.1 Homeodomain 161..217 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..257 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.