DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and isx

DIOPT Version :10

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_031754414.1 Gene:isx / 116409679 -ID:- Length:285 Species:Xenopus tropicalis


Alignment Length:103 Identity:26/103 - (25%)
Similarity:38/103 - (36%) Gaps:23/103 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 KHH-------HTVPEHPAYQYAHPQPVAVYSSTTP-----RPVSYSSVSPSTTPAPVHETPSYPV 302
            |||       .|:..:||      .|.:..|..||     .|....|.|...:||.|..||:   
 Frog    24 KHHGKSRSFVSTLKSNPA------TPTSKLSLKTPERRTANPNHDMSGSKGKSPASVFRTPT--- 79

  Fly   303 YHPSVKPPRHNRTEYANRQRFYPQSMRHPSQHKPRPIP 340
            ...||.......|  :..::.:.|.....||::.:.||
 Frog    80 SGQSVSTCSSKNT--SKTKKHFSQLKMLLSQNESQKIP 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 7/26 (27%)
isxXP_031754414.1 Homeodomain 133..189 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.