DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and Cphx1

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_780551.1 Gene:Cphx1 / 105594 MGIID:2145733 Length:182 Species:Mus musculus


Alignment Length:192 Identity:48/192 - (25%)
Similarity:67/192 - (34%) Gaps:54/192 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 PSDEDISDCESEPGIALKR---KQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTE 254
            |...:..|..|:   |.||   :..:.|..||..:|..|::.|....|||..|::|||::.....
Mouse     7 PGAPETKDNRSK---ARKRYGSRNSKPRHKFSRDELKRLKQEFAYAPYPDFTTKDELARQFQCEV 68

  Fly   255 ARIQVWFSNRRARLRKQ------------------HTSVSGGAPGGAAASVSHVAASSSLPSVVS 301
            :.|..||.|:||||..:                  .|......|..|:..     ..||..|||.
Mouse    69 SVIDNWFQNKRARLAPELKSKISAMRRMRRCQDYMRTGHQDTQPPKASGE-----QYSSCDSVVR 128

  Fly   302 SVPSMAPLAMMPGSLDPATVYQQQYDFYGSHANISVSAAAPMASSNLSPGITTTPPHHHQFY 363
            |:          |.....||..|               .|....|:..|...|.||.:.|:|
Mouse   129 SI----------GRQSIGTVEHQ---------------GAAGRESSFRPTNFTFPPVYEQYY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475 20/51 (39%)
Cphx1NP_780551.1 homeodomain 29..82 CDD:238039 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.