DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and gsc2

DIOPT Version :10

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_017946465.2 Gene:gsc2 / 101734976 XenbaseID:XB-GENE-22064768 Length:181 Species:Xenopus tropicalis


Alignment Length:116 Identity:44/116 - (37%)
Similarity:60/116 - (51%) Gaps:18/116 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 HHNNGKPSDEDISDCESEPGIAL-----KRKQRRCRTTFSASQLDELERAFERTQYPDIYTREEL 246
            |.|:|...    :....||...|     :|:.||.||.|:..||..||:.|...||||:..||:|
 Frog    76 HANHGDAG----AAVTVEPPTLLSLPHTQRRTRRHRTIFTEDQLQALEQTFHHNQYPDVIAREQL 136

  Fly   247 AQRTNLTEARIQVWFSNRRARLRKQHTSVSGGAPGGAAASVSHVAASSSLP 297
            |.|..|.|.|::|||.||||:.|:|..         .||||..:.|:.::|
 Frog   137 AGRIQLKEERVEVWFKNRRAKWRRQKR---------GAASVIILQAAKNVP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 29/55 (53%)
gsc2XP_017946465.2 Homeodomain 109..160 CDD:459649 25/50 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.