DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and LOC100485335

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_002938577.1 Gene:LOC100485335 / 100485335 -ID:- Length:281 Species:Xenopus tropicalis


Alignment Length:316 Identity:94/316 - (29%)
Similarity:132/316 - (41%) Gaps:91/316 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 DNDMSSASGSPAGDGTKASSSCGSDVSGGHHNNGKPSDEDISDCESEPGIALKRKQRRCRTTFSA 222
            ||.::..|.:......:..||..|:     |..|..:| |:.  ||:..:.||||.:|.||:|:.
 Frog    29 DNIVTGQSNTTIDSCQQLDSSLDSE-----HQPGAAND-DLD--ESQIRLQLKRKLQRNRTSFTQ 85

  Fly   223 SQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRA------RLRKQHTSVSGGAPG 281
            .|::.||:.||||.|||::.||.||.:.:|.|||||||||||||      :||.|....|.    
 Frog    86 EQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASN---- 146

  Fly   282 GAAASVSHVAASSSL-PSVVSSVPSMAPLAMMPGSLDPATVYQQQYDFYGSHANISVSAAAPMAS 345
                :.||::.:||. .||..|:|..:....|.|..:.|..     :.|||              
 Frog   147 ----TSSHLSINSSFSSSVYQSIPQPSNSGSMLGRSEAAIT-----NSYGS-------------- 188

  Fly   346 SNLSPGITTTPPHHHQFYNPSANTASYIMPGENGNTTPTGNIIVSSYETQLGSVYGTETETHQTM 410
                     .||           ..|:.||    |..|...|             .::|.|:..|
 Frog   189 ---------LPP-----------LPSFTMP----NNLPIQPI-------------ASQTSTYSCM 216

  Fly   411 PRNESPNESVSSAFGQLPP-TPNSLSAVVSGAGVTSSSGANS----------GADP 455
             .:.||:.||.|.....|| ....:|....|:|.:||:|..|          |.||
 Frog   217 -ISSSPSVSVRSYDAYTPPQLQTHMSNQNLGSGASSSTGLISPGVSVPVQVPGGDP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475 31/57 (54%)
LOC100485335XP_002938577.1 Homeobox 80..133 CDD:365835 31/52 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.