DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and pax10

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001373372.1 Gene:pax10 / 100192208 ZFINID:ZDB-GENE-081022-10 Length:275 Species:Danio rerio


Alignment Length:291 Identity:84/291 - (28%)
Similarity:117/291 - (40%) Gaps:95/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 EDISDCESEPGIALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVW 260
            :::.|  |:..:.||||.:|.||:|:..|:|.||:.||||.|||::.||.||.:.:|.|||||||
Zfish    59 DEVDD--SQLHLQLKRKLQRNRTSFTQEQIDALEKEFERTHYPDVFARERLAAKIDLPEARIQVW 121

  Fly   261 FSNRRA------RLRKQHTSVSGGAPGGAAASVSHVAASSSLPSVVSSVPSMAPLAMMPGSLDPA 319
            ||||||      :||.|..|.|     .::.|.:|...|:|..|.|                   
Zfish   122 FSNRRAKWRREEKLRNQRRSGS-----SSSCSQTHTPLSTSFNSPV------------------- 162

  Fly   320 TVYQQQYDFYGSHANISVSAAAPMASSNLSPGITTTPPHHHQFYNPSANTASY--IMPGENGNTT 382
                     |.||.:.|..:....:.|:|| |.::..........||.:|.:|  ::|.......
Zfish   163 ---------YHSHHSNSSGSMHSRSDSSLS-GYSSLSVFSSMQSLPSQSTPTYSCMLPPSPSALP 217

  Fly   383 PTGNIIVSSYETQLGSVYGTETETHQTMPRNESPNESVSSAFGQLPPTPNSLS-----AVVSGAG 442
            |......|||           |..|                   |||.|.:.:     |.||.||
Zfish   218 PLSRKFDSSY-----------TSPH-------------------LPPPPTASANTGFFAGVSAAG 252

  Fly   443 VTSSSGANSGADPSQSLANASAGSEELSAAL 473
            .|:..|                |.:||...|
Zfish   253 QTAVQG----------------GDQELGQGL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475 32/57 (56%)
pax10NP_001373372.1 Homeobox 78..131 CDD:395001 32/52 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.