DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prd and shox2

DIOPT Version :9

Sequence 1:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001093694.1 Gene:shox2 / 100101703 XenbaseID:XB-GENE-480993 Length:311 Species:Xenopus tropicalis


Alignment Length:388 Identity:98/388 - (25%)
Similarity:144/388 - (37%) Gaps:125/388 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 FSWEIREKLIREGVCDRSTAPSVSAISRLVRGRDAPLDNDMSSASGSPAGDGTKASSSCGSDVSG 185
            |..:|:||  :|.:..|....|..|     ||::            ...|:|.:.....|:...|
 Frog    12 FDQKIKEK--KEMITYREVLESGPA-----RGKE------------PGCGEGAREDGLAGNRCIG 57

  Fly   186 GH------------------------HNNGKPSDEDISDCESEPGIALKR-----------KQRR 215
            |.                        ..:|.|...::|....|....||:           ||||
 Frog    58 GGGGGGGGGGGARSPVLELDLSVERIRESGSPKLTEVSPEIKERKEELKQQALEEEGQTKIKQRR 122

  Fly   216 CRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRKQHTSVSGGAP 280
            .||.|:..||:||||.|:.|.|||.:.||||:||..|:|||:||||.||||:.|||...:..|..
 Frog   123 SRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVL 187

  Fly   281 GGAAASVSHVAASSSLPSVVSSVPSMAPLAMMPGSLDPATVYQQQYDFYGSHANISVSAAAPMAS 345
            .||.   |...|....|.|  :|.::    .||        :||.     ||.|:...:....|.
 Frog   188 IGAG---SQFEACRVAPYV--NVGAL----RMP--------FQQD-----SHCNVPSLSFQVQAQ 230

  Fly   346 SNLSPGITTTPPHHHQFYNPSANTASYIMPGENGNTTPTGNIIVSSYETQLGSVYGTETETHQTM 410
            ..|...:...  |||...:.:|:....:.|     ..|.|                        :
 Frog   231 LQLDSAVAHA--HHHLHPHLTAHAPYMMFP-----APPFG------------------------L 264

  Fly   411 PRNESPNESVSSAFGQLPPTPNSLSAVVSGAGVTSSSGANSGADPSQSLANASAGSEELSAAL 473
            |......|:.::|            :||:.|....:|..||      |:|:....:::.:|||
 Frog   265 PLATLAAETATAA------------SVVAAAAAAKTSSKNS------SIADLRLKAKKHAAAL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prdNP_723721.1 PAX 27..154 CDD:238076 10/32 (31%)
Homeobox 217..269 CDD:278475 32/51 (63%)
shox2NP_001093694.1 Homeobox 123..177 CDD:365835 32/53 (60%)
OAR 292..307 CDD:367680 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.