DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment firl and Hsd17b12

DIOPT Version :10

Sequence 1:NP_001033900.2 Gene:firl / 34627 FlyBaseID:FBgn0032405 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_114455.2 Gene:Hsd17b12 / 84013 RGDID:708367 Length:312 Species:Rattus norvegicus


Alignment Length:223 Identity:61/223 - (27%)
Similarity:99/223 - (44%) Gaps:42/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GEIVLITGTGHGIGRELALHYASLGSTVVCV------------DIDGKNNLQTVEKAKRLNLGEV 107
            ||..::||...|||:..|...|..|..:|.:            :|..|.|::|...|...:|.::
  Rat    50 GEWAVVTGGTDGIGKSYAEELAKRGMKIVLISRSQDKLKEVSNNIKEKFNVETRTIAVDFSLDDI 114

  Fly   108 YSYSCDVSKRDEVTALADRIKSDVGC--ISVLVNNVGIMPTHP----ILQQSAEEIQRVFDVNVF 166
            |                |:||:.:..  |.|||||||:...:|    .:......|:::.::||.
  Rat   115 Y----------------DKIKTGLSGLEIGVLVNNVGMSYEYPEYFLEIPDLDNTIKKLININVL 163

  Fly   167 SQFWTIQAFLPHMQEKCRGHIICMSSIAGLVGISNLVPYCATKFAVRGLMEALHAELR-QGPFRD 230
            |.....:..||.|.|:.:|.|:.:||.:|::.:..|..|.|||..|....:.||.|.: :|.|  
  Rat   164 SICKVTRLVLPGMVERSKGVILNISSASGMLPVPLLTVYSATKAFVDFFSQCLHEEYKSKGIF-- 226

  Fly   231 LIRTTTIFPYMTNTGLCK--HPKVKFPS 256
               ..::.|:...|.|.|  .|.:..||
  Rat   227 ---VQSVLPFFVATKLAKIRKPTLDKPS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
firlNP_001033900.2 17beta-HSDXI-like_SDR_c 57..299 CDD:187598 59/221 (27%)
Hsd17b12NP_114455.2 17beta-HSD1_like_SDR_c 50..289 CDD:187614 61/223 (27%)
Di-lysine motif. /evidence=ECO:0000250 308..312
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.