DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7-like and MRPL33

DIOPT Version :9

Sequence 1:NP_001097151.1 Gene:RpL7-like / 34625 FlyBaseID:FBgn0032404 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_014013.1 Gene:MRPL33 / 855330 SGDID:S000004899 Length:86 Species:Saccharomyces cerevisiae


Alignment Length:51 Identity:13/51 - (25%)
Similarity:24/51 - (47%) Gaps:14/51 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 TTADIFRTLRMGSRHNAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELV 162
            ||..|.::|.:|.|.:.|:           :.:.|.:.   .||:.::|||
Yeast    18 TTKSIVKSLGLGKRGSIVY-----------KKVNPAIA---GSLAKVKELV 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7-likeNP_001097151.1 uL30_euk 18..257 CDD:273548 13/51 (25%)
Ribosomal_L7_archeal_euk 97..257 CDD:100099 13/51 (25%)
MRPL33NP_014013.1 Ribosomal_L30 4..57 CDD:100100 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.