DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7-like and RPL7A

DIOPT Version :9

Sequence 1:NP_001097151.1 Gene:RpL7-like / 34625 FlyBaseID:FBgn0032404 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_011439.1 Gene:RPL7A / 852804 SGDID:S000003044 Length:244 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:85/246 - (34%)
Similarity:139/246 - (56%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RILQDESVV-----TQKRNDRI-KKRTATKNHHKFRRAESFVM----GYLKAERTSKRIKQTILR 79
            :||..||.:     .||..::: .:|.|.|..:|.:||  .::    .|.|...|::|   .|::
Yeast     5 KILTPESQLKKSKAQQKTAEQVAAERAARKAANKEKRA--IILERNAAYQKEYETAER---NIIQ 64

  Fly    80 TNVTEQSAKAAD----DSNPKLLFVMRHAGKKIFDKTTADIFRTLRMGSRHNAVFMENTKENQLL 140
               .::.||||.    ::..||:||:|..|..........:.:.||:...::..|::.||....|
Yeast    65 ---AKRDAKAAGSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVTKATLEL 126

  Fly   141 LRVIEPFVVYGNPSLSSIRELVFKKGFARIDGKKTAIQSNTMVEQQLGDKGVICLEDIIHEICTV 205
            |::|||:|.||.||.|:||:||:|:||.:|:.::..:..|.::|..||..|::.::|:||||.||
Yeast   127 LKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLGKYGILSIDDLIHEIITV 191

  Fly   206 GPNFAAVNEFLCAFTLSSPSNGWQKKVSVSYK---RGGEYGDRGTAINELI 253
            ||:|...|.||..|.||:||.||  .|...:|   :||.:|:|...||:|:
Yeast   192 GPHFKQANNFLWPFKLSNPSGGW--GVPRKFKHFIQGGSFGNREEFINKLV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7-likeNP_001097151.1 uL30_euk 18..257 CDD:273548 85/246 (35%)
Ribosomal_L7_archeal_euk 97..257 CDD:100099 63/160 (39%)
RPL7ANP_011439.1 uL30_euk 10..244 CDD:273548 83/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S407
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001677
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.820

Return to query results.
Submit another query.