DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7-like and AT2G44120

DIOPT Version :9

Sequence 1:NP_001097151.1 Gene:RpL7-like / 34625 FlyBaseID:FBgn0032404 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_850411.1 Gene:AT2G44120 / 819018 AraportID:AT2G44120 Length:247 Species:Arabidopsis thaliana


Alignment Length:259 Identity:92/259 - (35%)
Similarity:140/259 - (54%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KYAVPNKLPGKTVSVLKHRKRR-----ILQDESVVTQKRNDRIKKRTATKNHHKFRRAESFVMGY 63
            |..||.       ||||..||:     ..:||:|..:|::...:|..       |:|||.:...|
plant    10 KVVVPE-------SVLKKIKRQEEWALAKKDEAVAAKKKSVEARKLI-------FKRAEQYAKEY 60

  Fly    64 LKAERTSKRIKQTILRTNVTEQSAKAA--DDSNPKLLFVMRHAGKKIFDKTTADIFRTLRMGSRH 126
            .:.:....|:|:        |...|..  .|...||||::|..|....|..|..|.:.||:....
plant    61 AEKDNELIRLKR--------EAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIF 117

  Fly   127 NAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFARIDGKKTAIQSNTMVEQQLGDKG 191
            |.||::..|....:||.:||:|.||.|:|.|::||::|:|:.:::.::.|:..|::|:|.||..|
plant   118 NGVFLKVNKATVNMLRRVEPYVTYGYPNLKSVKELIYKRGYGKLNHQRIALTDNSIVDQALGKHG 182

  Fly   192 VICLEDIIHEICTVGPNFAAVNEFLCAFTLSSPSNGWQKKVSVSYKRGGEYGDRGTAINELIAR 255
            :||:||:||||.||||:|...|.||..|.|.:|..|.:||.: .|..||:.|:|...||||:.|
plant   183 IICVEDLIHEIMTVGPHFKEANNFLWPFQLKAPLGGLKKKRN-HYVEGGDAGNRENFINELVRR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7-likeNP_001097151.1 uL30_euk 18..257 CDD:273548 88/245 (36%)
Ribosomal_L7_archeal_euk 97..257 CDD:100099 67/159 (42%)
AT2G44120NP_850411.1 uL30_euk 15..247 CDD:273548 89/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001677
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.