DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7-like and AT2G01250

DIOPT Version :9

Sequence 1:NP_001097151.1 Gene:RpL7-like / 34625 FlyBaseID:FBgn0032404 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_178234.1 Gene:AT2G01250 / 814652 AraportID:AT2G01250 Length:242 Species:Arabidopsis thaliana


Alignment Length:258 Identity:96/258 - (37%)
Similarity:142/258 - (55%) Gaps:22/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDKYAVPNKLPGKTVSVLKHRKRRILQDESVVTQKRN-DRIKKRTATKNHHKFRRAESFVMGYL 64
            :..|..||.       ||||.|||   ::|..:.:|:| :..||:.|......|:|||.:...|.
plant     2 VESKVVVPE-------SVLKKRKR---EEEWALEKKQNVEAAKKKNAENRKLIFKRAEQYSKEYA 56

  Fly    65 KAERTSKRIKQTILRTNVTEQSAKAA--DDSNPKLLFVMRHAGKKIFDKTTADIFRTLRMGSRHN 127
            :.|:....:|:        |...|..  .|...||||::|..|....|..|..|.:.||:....|
plant    57 EKEKELISLKR--------EAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFN 113

  Fly   128 AVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFARIDGKKTAIQSNTMVEQQLGDKGV 192
            .||::..|....:||.:||:|.||.|:|.|::||::|:|:.:::.::.|:..|::|||.||..|:
plant   114 GVFLKVNKATMNMLRRVEPYVTYGFPNLKSVKELIYKRGYGKLNHQRIALTDNSIVEQALGKHGI 178

  Fly   193 ICLEDIIHEICTVGPNFAAVNEFLCAFTLSSPSNGWQKKVSVSYKRGGEYGDRGTAINELIAR 255
            ||.||:||||.||||:|...|.||..|.|.:|..|.:||.: .|..||:.|:|...|||||.|
plant   179 ICTEDLIHEILTVGPHFKEANNFLWPFQLKAPLGGLKKKRN-HYVEGGDAGNRENFINELIRR 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7-likeNP_001097151.1 uL30_euk 18..257 CDD:273548 92/241 (38%)
Ribosomal_L7_archeal_euk 97..257 CDD:100099 69/159 (43%)
AT2G01250NP_178234.1 uL30_euk 10..242 CDD:273548 93/250 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001677
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.